<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA18329 CA42806 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C   K82R, R83K, K102R, D123N, K173N, T200A, E203EK, R211K, E297K  
>CA42806| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNRKTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRNQNPDIVI
CQYVDDLYVGSDLEIGQHRAKIKELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37D, R41K, L63P, K70R, L89M, I93L  
>CA42805| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009