Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA1498 | CA4280 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | D4T | 61 |
| 2 | AZT | 44 |
| 3 | 3TC+AZT+SQV | 82 |
| 4 | 3TC+AZT | 6 |
| 5 | 3TC+AZT+IDV | 35 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L90M | L10FI, G73S | L63P, K70R, A71V, I72L | L23LV |
| >CA4280| codons 1-99 PQITLWQRPFVTIKIGGQLKEAVLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD QIPIEICGHRVLSTVLVGPTPVNIIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Rhee, SY | Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. | J Infect Dis, 2009 |