<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1498 CA4280 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 61
2 AZT 44
3 3TC+AZT+SQV 82
4 3TC+AZT 6
5 3TC+AZT+IDV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L10FI, G73S L63P, K70R, A71V, I72L L23LV
>CA4280| codons 1-99
PQITLWQRPFVTIKIGGQLKEAVLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHRVLSTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Rhee, SY Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. J Infect Dis, 2009