<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1497 CA4278 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 152
2 AZT+ DDI 17
3 3TC+ AZT 17
4 AZT+ 3TC+ IDV 34
5 D4T+ DDI+ RTV 43
6 DDI+3TC+NVP+SQV+RTV+D4T 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M Q58E, G73T L10I, K20I, K55R, L63P, A71V  
>CA4278| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVRVREYD
QIPIEICGHKVITTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   Y181C, G190A A98G K20R, V35I, K43E, E44D, V118I, D123E, I135T, D177E, T200K, Q207D, H208Y, R211K, E248D, A272S, K277R, I293V  
>CA4279| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVASDLEIGQHRKKIEELRDYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGTKALTEVVPLTEEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005