<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14449 CA42758 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 117
2 3TC+AZT+IDV 21
3 3TC+ABC+AZT+IDV 52
4 3TC+ABC+AZT+IDV+RTV 186

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     K11KRT, T39TS, T69N, K122P, D123S, L210F, V245K  
>CA42758| codons 1-266
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALVEICSEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPSFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLFRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, L76LV, V82VA K43KT L10V, E35ED, N37ND, R41K, I62IV, L63LP, I64V, I93IL  
>CA42757| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDMDLPGKWTPKIIGGIGGFVKVRQYD
QVPVEICGHKAIGTVVVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009