<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14341 CA42751 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 18
2 3TC+AZT 17
3 3TC+AZT+IDV 43
4 D4T+SQV 44
5 DDI+NVP+SQV 61
6 3TC+AZT+IDV 231
7 D4T+EFV+TDF 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73C I15V, Q18H, K20I, M36I, N37D, D60E, I62V, L63P, A71T, I72E, I93L  
>CA42751| codons 1-99
PQITLWQRPLVTIKVGGHLIEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFIKVRQYE
QVPIEICGHKTECTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, T215Y D67G K101E, G190S   E28K, V35M, K43E, T69N, R83K, K122P, S162C, D177E, I195L, V276T, K277R  
>CA42752| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALMEICTELEEEGKISKIGPENPYNTPV
FAIKKKGSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLYVSSDLELGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKTRQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009