<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14192 CA42733 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 48
2 D4T+DDI 17
3 AZT 39
4 3TC+AZT+IDV 35
5 D4T+DDI+NVP 26
6 D4T+DDI+NFV 35
7 3TC+RTV+SQV 57
8 3TC+ABC+EFV+RTV+SQV 174
9 3TC+ABC+APV+DDI+LPV+TDF 95

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M V11I, G73S, L89V L10I, K14R, K20V, L63P, A71I, P79A, I93L  
>CA42733| codons 1-99
PQITLWQRPIITIRIGGQLVEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKIISTVLVGATPVNVIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184MV, L210W, T215Y K219R Y181C, G190A V108I, V179F K11R, V21I, V35VI, K43E, E44A, R83K, K101Q, K103R, L109I, V118I, K122E, R172K, D177E, G196E, R211K, D218E, L228R, T286P, A288S, I293V, E297R  
>CA42734| codons 1-300
PISPIETVPVRLKPGMDGPKIKQWPLTEEKIKALIEICTELEEAGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLQKRKSVTIIDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPEIFI
CQYVDDLYVASDLEIEQHRTKIEELRQHLWKWGFYTPERKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGPKSLTEVVPLTREAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005