<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9942 CA42731 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 9
2 None 30
3 D4T+DDI+RTV+SQV 9
4 None 39
5 D4T+DDI+RTV+SQV 48
6 None 57
7 3TC+AZT+EFV 104
8 None 33

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35ED, L63C, A71T  
>CA42731| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QICIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215TFIS   K103N K101KN E28EK, V35MR, K122E, D123N, I135T, K173Q, D177E, Q197K, A272P, R284K, T286A, E297A  
>CA42732| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALREICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLNKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPEIVI
YQYVDDLYVGSDLEIGKHRTKIEELRQHLLRWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVIPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005