<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA790 CA42719 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 365
2 AZT+DDC 22
3 3TC+AZT 31
4 3TC+AZT+IDV 9
5 3TC+D4T+IDV 60
6 D4T+DDI+RTV+SQV 58
7 D4T+DDI+EFV+RTV+SQV 28
8 D4T+DDI+EFV+SQV 18
9 Unknown 244

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V L10F, L24I, L33F, G73S I13V, G16GA, L19LI, L63P, I66V, I72V, P79D, I93L  
>CA42719| codons 1-99
PQITLWQRPFVTVKIAGQIKEALIDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYD
QIPIEVCGHKAVSTVLVGDTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, T215Y K219Q K101EQ, Y181C, G190S   V35I, T39A, K49R, V106VI, K122E, D123E, I135T, V179I, D218E, D237E, E248D, I293V, E297A  
>CA42720| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYMDDLYVSSDLEIGQHRTKIEELRQHLLRWGFYTPEQKHQKEPPFLWMGYELHPEKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005