<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5006 CA42714 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 35
2 3TC+AZT+SQV 65
3 D4T+DDI+NFV 81
4 APV+D4T+EFV 84
5 ABC+APV+D4T+DDI+RTV 139

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, T215F K219Q K101PS, K103S   E28EA, I50IT, V60I, T69N, K102KQR, K104KR, V118VI, K122E, I135T, S162CY, F214L, D218E, A272P  
>CA42714| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTELEKEGKISKTGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLSRSRSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, I47IV, I54L, L90LM L10F, L33F, N88D I13V, I15IV, L19I, Y59YH, I62V, L63P, H69HQ, V77VI  
>CA42713| codons 1-99
PQITLWQRPFVTVKVGGQIKEALLDTGADDTIFEEMNLPGRWKPKMVGGIGGFLKVRQHD
QVPIEICGQKAIGTVLIGPTPVNIIGRDLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005