<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4319 CA42703 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+NFV+NVP 20
2 NFV+RTV+SQV 6
3 3TC+DDC+NFV 43
4 3TC+DDC 39
5 3TC+AZT+EFV 18
6 APV+D4T+DDI+NVP 43
7 3TC+D4T+NVP 180

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, R57K, L63P, I64V, V77I  
>CA42703| codons 1-99
PQITLWQRPLVKIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIPVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215TFIS   K103N   I135IT, I142V, T165L, G196E, T200A, T286A, I293IV, P294PT, K311R  
>CA42704| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMLKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLLRWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVTLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009