<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8404 CA42701 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 9
2 IDV 30
3 3TC+AZT 87
4 D4T+DDI+NVP 256

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, V11A, T12P, I62V, L63S, I64IM, C67Y, A71V, I72IT, V77I, I93L  
>CA42701| codons 1-99
PQITLWQRPIAPIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVSMEIYGHKVTGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, L210W, T215Y V75T, K219N Y181C V108I K20KR, T39A, S68G, V118I, D121H, K122E, I135T, D177DE, I178IM, H221Y, V245M, A272P, L283I, I293V P140T
>CA42702| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETTGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDNKYQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005