<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1288 CA42699 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 4
2 3TC+AZT 26
3 3TC+AZT+IDV 43
4 AZT+DDI+IDV+NVP 17
5 3TC+D4T+RTV+SQV 82
6 3TC+D4T+EFV+SQV 24
7 Unknown 194

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37A, R41K, I62IV, L63A, A71AV, V77I, I93L, L97LI  
>CA42699| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMALPGKWKPKMIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTINF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, D123DN, I135IV, Q207QE, R211K, F214L, V245T, K277R, T286A, V292I, I293V, E297A  
>CA42700| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEIVPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005