<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8097 CA42697 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 35
2 3TC+AZT+RTV 39
3 3TC+AZT+NFV+NVP 91
4 3TC+ABC+AZT+NFV+NVP 213

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, K43KT I13V, L24F, I62IV, L63P, A71IV, V77I, I93L  
>CA42697| codons 1-99
PQITLWQRPLVTVKIGGQLKEALFDTGADDTVFEEMNLPGRWTPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N, Y181C   T39TA, E44D, K101KQ, T139R, D177E, I178M, G196E, R211T  
>CA42698| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNERPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYVDDLYVGSDLEIEQHRTKIEELRQHLWTWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKD

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    I72V, L101V, T124A, T125A, K156N, F181L, G193R, V201I, T206S, A265V, I268IV  
>CA124166| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFVLKLAGRWPVKTIHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNNELKKIIGQVRDQAEHLKTAVQMAV
LIHNFKRKGGIGRYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIVRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009