<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1159 CA42690 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 DDI 26
3 D4T 18
4 AZT+D4T+IDV 26
5 AZT+DDI+NVP+RTV+SQV 232
6 3TC+D4T+LPV 74
7 Unknown 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219E Y181C   K20KR, V35L, T69N, K102M, V179I, G196E, T200A, E203K, Q207E, F214FL, L228HR, E248D, A272P, T286A, E297K  
>CA42690| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKMKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVGSDLEIEQHRAKIKELREHLLRWGLTTPDEKHQKEPPFRWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82IT, I84V T74P L10Y, I15V, L19I, K20R, M36MI, K55N, D60E, L63PST, H69R, K70T, L89M  
>CA42689| codons 1-99
PQITLWQRPYVTIKVGGQIREALLDTGADDTVLEEINLPGRWKPKIIGGIGGFINVRQYE
QITIEICGRTAIGPVLVGPTPTNVIGRNMLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005