<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1293 CA42688 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 52
2 3TC+D4T 52
3 3TC+D4T+IDV 52
4 3TC+D4T+NFV+NVP 189
5 3TC+D4T+NFV 36
6 3TC+AZT+NFV 79
7 3TC+ABC+AZT+RTV+SQV+T20+TDF 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   Y181C V108I V35I, K43Q, E44D, A98S, K102Q, V118I, D121C, K122E, I135T, I142V, T200A, E203K, H208Y, K223Q, L228R, Q242L, V245M, A272P, K275R, K277R, P294T V179Q
>CA42688| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKQKKSVTILDVGDAYFSIPL
CEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIQI
CQYVDDLYVGSDLEIGQHRAKIKELRQYLWRWGFYTPDKKHQQEPPFRWMGYELHPDKWT
VLPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVITLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A, I84V L10F, L24I, L89V M36L, N37D, R41RK, Q61E, I62V, L63P, I64M, A71I, I72T, I93L  
>CA42687| codons 1-99
PQITLWQRPFVTIKIGGQLKEALIDTGADDTVLEELDLPGKWKPKLIGGIGGFIKVRQYD
EVPMEICGHKITGTVLVGPTPANVIGRNVLTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    R20K, D25E, S39C, L101I, G193E, V201I, L234I, S255T D286N
>CA124199| codons 1-288
FLDGIDKAQEEHEKYHSNWKAMASEFNLPPVVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGEYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNTDIKVVPRRKAKIIRDYGKQMAGDDCVASRQNED

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005