<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1492 CA4268 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 74
2 DDC+DDI 61
3 AZT+DDC 31
4 DDC 104
5 3TC+D4T 48
6 3TC+NVP 4
7 EFV+IDV 22
8 3TC+AZT+EFV+IDV 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   I15V, K43R, Q61E, I62V, L63P, I72V, I93L  
>CA4268| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
EVPIEICGHKAVGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MV, T215CY   K103N P225PH K20R, K49R, K101KQ, K122E, D177G, Q207E, R211K, A272P N265NI
>CA4269| codons 1-290
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLIWASQIYPGIKVKQLCKLLRGTKALT

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005