<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9710 CA42666 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+D4T+EFV+LPV 9
3 None 35
4 3TC+APV+D4T+RTV 9
5 3TC+ABC+AZT 30
6 None 22
7 3TC+D4T+LPV 70

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV T215TILP G190A   V35E, T39A, K101S, K122KE, I135K, V179I, R211K, I244IV, V245VAMT, A272P, K281KR, T286A  
>CA42666| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLSKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFPTPDKKHQKEPPFLWMGYELHPDKWT
VQPVTLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73GS L10I, T12E, K20I, E35D, M36MI, I62V, L63P, K70R, A71V, V77I, I93IL  
>CA42665| codons 1-99
PQITLWQRPIVEIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHRVISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005