<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9680 CA42664 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 374
2 DDI+EFV+TDF 44

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V, M184MV T215V, K219Q L100I, K103N   K20R, T39A, S48T, V60I, T69TN, D123E, D177G, Q207E, R211K, F214L, D218E, A272P, E297EA, Q334L  
>CA42664| codons 1-340
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKITKIGPENPYNTPI
FAIKKKNSNRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLVTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, R57K, I62V, L63P, A71AV, V77I, I93L  
>CA42663| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVKQYD
QVPIEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005