<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8395 CA42657 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 174
2 D4T+DDI+RTV+SQV 157

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54L, I84V, L90M L33F, N88D I13V, N37PS, R41K, D60E, I62V, L63P, C67W, A71T, I72T, V77I, I93L  
>CA42657| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVFEEMSLPGKWKPKMIGGIGGFLKVRQYE
QVPIEIWGHKTTGTVLIGPTPVNVIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     T39TA, K64H, T69N, K122P, I142V, Q174QR, D177E, I178L, R211RK, A272P, T286A  
>CA42658| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005