<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1490 CA4265 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 82
2 D4T 57
3 3TC+AZT 26
4 3TC+AZT+IDV 22
5 3TC+D4T+IDV 35
6 DDI+DLV+NFV 17
7 D4T+RTV+SQV 37

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215Y K219Q K103KN, Y181C   K20R, V106I, I135V, E138EQ, G196EQ, R211T, F214L, H221Y  
>CA4265| codons 1-265
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNQTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIQQHRTKIEELRQHLLTWGLYTPDQKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M K43T, F53L, L89V L10V, I13V, I15IV, K20X, M36I, N37D, K55KR, L63P, I64IM, A71V  
>CA4264| codons 1-99
PQITLWQRPVVTVKVGGQLXEALLDTGADDTILEEIDLPGRWTPKIIGGIGGLIRVRQYD
QIPMEICGHKVIGTVLVGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005