<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1590 CA42641 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 139
2 AZT+DDC+IDV 26
3 D4T+DDC+IDV 52
4 3TC+DDI+RTV+SQV 22
5 D4T+DDI+IDV+NFV 58
6 ABC+APV+NVP+RTV 255

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82L, L90M L33F, G73T, L89V L10I, V11L, T12E, I13V, L19IM, M36I, R41K, L63P, A71V, V77I, I93L  
>CA42641| codons 1-99
PQITLWQRPILEVKIGGQMKEALLDTGADDTVFEEINLPGKWKPKIIGGVGGFVKVRQYD
QIPIEICGHKVITTVLIGPTPLNIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y K219N Y181C, M230L   E44D, V60I, V118I, K122E, I135T, G196E, T200I, E203K, Q207D, H208Y, R211K, K223E, L228R, D237DE, A272P, K275KR  
>CA42642| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRIKIKELRDYLWKWGFYTPDNKHQEEPPFRWLGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005