<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4323 CA42637 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 DDI 148
3 AZT+DDC+DLV 83
4 RTV+SQV 35
5 D4T+EFV+RTV+SQV 31
6 3TC+ABC+APV+D4T 178
7 3TC+ABC+APV 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, I54L, I84V, L90M L10F, V11VI, L33F, Q58QE, G73GS, L89V I13V, K20T, E35DN, M36I, R41K, D60E, I62V, L63P, C67CY, A71V, I72IM, P79H  
>CA42637| codons 1-99
PQITLWQRPFITVKIGGQLTEALLDTGADDTIFENINLPGKWKPKMIGGIGGFLKVREYE
QVPIEIYGHKVMSTVLVGHTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y V75T, K219D K103N L234I V35IM, K43E, K64R, V118I, K122E, G196E, T200A, E203K, Q207E, D218E, F227Y, L228H, T286A, I293V, L303M E302G
>CA42638| codons 1-307
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEEEGKISKIGPENPYNTPV
FAIRKKNSTKWRKITDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIKELREHLWRWGFYTPEDKHQKEPPYHWMGYEIHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LGMAENR

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005