<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2073 CA42632 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 48
2 AZT+DDC+DDI 26
3 D4T+DDI+SQV 31
4 3TC+AZT+IDV 43
5 D4T+DDI+IDV 26
6 3TC+AZT+IDV 83
7 ABC+APV+D4T+EFV 272

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L74LI, L210W, T215Y K219KDEN, N348I K103N, Y181CG V108I E6ED, T27S, K43E, E44A, V90VI, K101KQ, V118I, K122E, I142IV, A158S, I202V, R211K, H221HY, L228R, A272P, I326V, I329V, Q334D  
>CA42632| codons 1-352
PISPIDTVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEIQLGIPHPAGLQKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
GQYMDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTPDNKYQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEVQKQGDGQWTYQIYQEPFKILKTG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A, L90M   L10I, I15V, K20I, E35ED, M36I, N37D, L63P, A71V, I93L  
>CA42631| codons 1-99
PQITLWQRPIVTIKVGGQLIEALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005