<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8070 CA42625 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T 178
2 3TC+AZT+NFV 8
3 None 85
4 3TC+AZT+NFV 63

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   N37H, L63PR, I64V, K70E, V77I, I93IL  
>CA42625| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVRQYD
QIRVEICGHEAIGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215FY V75M, F77L     V21VI, E79ED, K102KE, K104R, I135V, S162DY, G196E, T200TIM, E203D, L283LF, R284K, T286A, I293V, E297K  
>CA42626| codons 1-301
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDLRDLNKRTQDFWEVQLGIPHPAGLKEKRSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRMKIDELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLFKGAKALTEVVPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009