<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7066 CA42624 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC 29
2 3TC+AZT 13
3 3TC+AZT+IDV 22
4 DDI+NFV+NVP 20
5 RTV+SQV 48
6 ABC+D4T+EFV 248

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KR K103N, Y181C V179F S3SG, K20R, V35VL, K43KE, E44EA, K49KR, K82R, A98S, S117SA, S163ST, D177E, G196E, T200TA, E203D, Q207K, R211A, H221Y, L228LR, K263KR, A272P, I293V V111VIM
>CA42624| codons 1-302
PIGPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTELEEAGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNRRTQDFWEVQLGIPHPSGLKKNKSVTVLDMGDAYFAVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRKQNPEIFI
CQYMDDLYVGSDLEIEQHRAKIDELRKHLWAWGFYTPDRKYQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGRLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R57K, I62V, L63P, A71V, I72V, V77I, I93L  
>CA42623| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKVVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005