<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1391 CA42618 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 209
2 3TC+ADV+AZT 39
3 3TC+D4T+IDV 39
4 3TC+DDI+RTV+SQV 35
5 3TC+EFV+NFV+SQV 30
6 3TC+ABC+D4T+DDI 61
7 3TC+AZT+IDV 76
8 3TC+AZT+IDV+RTV 43
9 3TC+AZT+LPV+TDF 13
10 3TC+AZT+DDI+LPV+TDF 36
11 3TC+DDI+NVP+TDF 20
12 3TC+ABC+AZT+TDF 11
13 3TC+ABC+AZT+LPV+TDF 19

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190A   I50IV, K102Q, K122E, K173E, D177E, I178M, V245E, A272P, K277R  
>CA42618| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPEMVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G17DE, K20R, M36I, R57K, L63P  
>CA42617| codons 1-99
PQITLWQRPLVTIKIGEQLREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005