<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3972 CA42601 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT+IDV 104
3 AZT+D4T+SQV 87
4 3TC+AZT+NFV 48
5 3TC+AZT+IDV+RTV 40
6 ABC+APV+D4T 67
7 3TC+EFV+IDV+RTV 97
8 3TC+AZT+TDF 57
9 3TC+ATV+RTV+TDF 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L10FI, V11VI, G73S, T74P I13IV, K20I, L33LV, E35D, M36MIV, I62V, L63P, A71V, I93L  
>CA42601| codons 1-99
PQITLWQRPIITVKIGGQLIEALLDTGADDTVVEDVNLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVISPVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y K219N   K101H E40F, K43E, V118I, K122E, I142IV, S162C, E169D, H208Y, R211K, D218DE, V245M, I293V  
>CA42602| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPENKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005