<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6421 CA42595 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 386

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I G73S L10I, K20I, I62V, L63P, H69R, V77I, Q92K, I93L, C95F  
>CA42595| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGRKAISTVLIGPTPVNIIGRNLLTKLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       I135L, T200A, Q207H, Q278H, I293V  
>CA42596| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRHHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005