<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5153 CA42583 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 56
2 AZT+DDI 17
3 D4T 47
4 3TC+D4T+IDV 182
5 ABC+D4T+EFV+NFV 228

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82VA   E35D, N37D, K43R, L63P, V77VI, I93L  
>CA42583| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEDMDLPGRWRPKIVGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F K219Q K103N, V106M   V60I, V118I, I135T, Q174H, V179VI, T200A, Q207R, R211E, F214L, L228R, I293V, I329IL, E344EG, Y354H, K366KR, T369TA, A376T, T386TS, K390R, A400T, T403TA, E404D, V435A, A437IV, D460N, R461K, H483HY, L491S, S519SN, K540KT, A554ADNT, K558R  
>CA42584| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELRRHLLEWGLFTPDQKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQGPFKNLKTGKHARMRGA
HTNDVRQLAEAVQKITTESIVIWGKSPKFRLPIQKETWETWWADYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGVETFYVDGAANRETKLGKAGYVTNKGRQKVVSLTDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHT
GIGGNEQVDKLVSTGIRRVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005