<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7062 CA42582 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215I, K219E, N348I     V21I, A98S, R211K, V245E, A272P, K281R, E291D, I293V, E297N, Q334E, G335S, I341F, G359S, K366R, T369A, A371V, A376N, T377L, K390R, A400T, V435A, S468P, A554N N306D
>CA42582| codons 1-560
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFITPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTDVVPLTNEAE
LELAEDREILKEPVHGVYYDPSKDLIAEIQKQGESQWTYQFYQEPFKILKTGKYARMRSA
HTNDVRQLAEVVQKINLESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSNGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, K20R, M36I, R57K, I62V, L63P, C67Y, V82I  
>CA42581| codons 1-99
PQITLWQRPLVTIKIGGQIREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
QVPIEIYGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009