Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA1486 | CA4257 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 209 |
| 2 | 3TC+AZT+SQV | 39 |
| 3 | D4T+RTV+SQV | 61 |
| 4 | 3TC+D4T+NFV+NVP | 22 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I84V, L90M | G73S | L10I, E35D, M36I, N37D, I62V, L63P, A71V | L23LV |
| >CA4257| codons 1-99 PQITLWQRPIVTIKIGGQLKEAVLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD QVPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| M41L, V75M, M184V, L210W, T215Y | K103KN, Y181C | A98AG, G190GR | V35I, E44D, R83RK, K122E, I135IT, I142T, T165TA, I178L, G196DE, T200A, K201KQ, H208HY, R211K | R199RIS, K219KI |
| >CA4256| codons 1-222 PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV FAIKKKDSTKWRKLMDFRELNKKTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL DEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMAKILEPFRKQNPDLVI CQYVDDLYVRSDLEIEQHSAQIEELRQYLWKWGFYTPDIKHQ |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. | AAC, 2004 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |