<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1486 CA4257 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 209
2 3TC+AZT+SQV 39
3 D4T+RTV+SQV 61
4 3TC+D4T+NFV+NVP 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, E35D, M36I, N37D, I62V, L63P, A71V L23LV
>CA4257| codons 1-99
PQITLWQRPIVTIKIGGQLKEAVLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215Y   K103KN, Y181C A98AG, G190GR V35I, E44D, R83RK, K122E, I135IT, I142T, T165TA, I178L, G196DE, T200A, K201KQ, H208HY, R211K R199RIS, K219KI
>CA4256| codons 1-222
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKKTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMAKILEPFRKQNPDLVI
CQYVDDLYVRSDLEIEQHSAQIEELRQYLWKWGFYTPDIKHQ

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005