<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL720 IL720 Israel 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ NVP+ DDI+ D4T+ AZT+ 3TC 341

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R   K103KT, V106M, G190A   T39E, S48T, K122E, D123DGNS, I142T, A158S, K166R, K173A, D177E, G196R, T200A, I202V, E203EK, Q207E, D237DN, V245Q E53EA
>IL720| codons 38-247
CEEMEKEGKITKIGPANPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKTKSMTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
SIFQSSMTRILEPFRAQNPEIVIYQYMDDLYVASDLEIRQHRAKVKELREHLLRWGFTTP
DKKHQKEPPFLWMGYELHPNKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q7R, I15V, L19I, M36I, R41K, H69K, L89M, I93L  
>IL720| codons 7-99
RRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEI
CGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005