<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL477 IL477 Israel 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI+ D4T 208

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       S48T, K65KE, V118VI, K122E, D123S, I135IT, K173T, D177E, T200A, Q207E, R211RK, V245Q  
>IL477| codons 40-247
ELEKEGKITKIGPENPYNTPVFAIKEKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRTQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDK
KHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D T12S, I15V, L19V, K20T, E35D, M36I, N37D, R41K, L63V, I64M, H69K, L89M, I93L  
>IL477| codons 4-99
TLWQRPFVSIKVGGQVTEALLDTGADNTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIV
MEICGKKAIGTVLVGPTPVNIIGRDMLTQLGCTLNF

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005