<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL433 IL433a Israel 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT+ IDV 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, V82A, L90LM Q58E I15V, K20R, M36I, K45KR, L63T, H69K, L89M, I93L L10C
>IL433a| codons 7-99
QRPCVTIKVGGQLREALLDTGADDTVLEEINLPGRWKPRLIGGIGGFIKVREYDQITIEI
CGKKAIGTVLVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W, T215Y       E40ED, G45X, V118VI, K122E, D123EG, A158S, K173A, Q174K, D177E, I178M, T200A, L205LF, Q207E, D237DN, V245Q M41W
>IL433a| codons 40-247
DWEKEXKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSIPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSI
FQSSMTKILEPFRAKNPEMVIYQYMDDLYVGSDLEIGQHRAKIEEFREHLWRWGFYTPDK
KHQKEPPFLWMGYELHPNKWTVQPIQLP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004