<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL428 IL428a Israel 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ 3TC+ AZT 50

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, M36I, R41K, H69K, T74S, L89M, I93L  
>IL428a| codons 4-99
TLWQRPLVSIKVGGQVKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48T, K122KE, S134SG, K173A, Q174K, D177E, G196K, T200A, Q207E, R211K, V245E D76DN, L120LS, K201KN
>IL428a| codons 40-247
EMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVNFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPSDEDFRKYTAFTIPGINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRAKNPEIVIYQYMDDLYVGSDLEIKQHRANIEELREHLLKWGFTTPDK
KHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004