<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL401 IL401 Israel 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ AZT+ 3TC 209

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39EG, K49KR, A98S, K122E, D123S, A158S, K173A, D177E, T200A, I202IV, L205LF, Q207G, R211RK, V245Q N137NI
>IL401| codons 38-246
CGEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINIETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRAQNPEIVIYQYMDDLYVGSDLEIGQHRAKVEEFRGHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   L10R, V11F, K14R, E35D, M36V, N37ND, R41K, L63P, I64IV, H69K, I72IV, L89LM, I93L D29DV
>IL401| codons 4-99
TLWQRPRFTIRIGGQLKEALLDTGAVDTVLEDVDLPGKWKPKMIGGIGGFIKVRQYDQIP
VEICGKKAVGTVLVGPTPVNIIGRNMMTQLGCTLNF

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005