<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL384 IL384b Israel 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 17
2 AZT+ DDC+ IDV 25
3 AZT+ IDV 39
4 3TC+ D4T+ SQV+ RTV 26
5 3TC+ D4T+ SQV 8
6 None 4
7 NFV+ 3TC+ D4T 39
8 D4T+ NFV+ SQV+ RTV+ 3TC 13
9 SQV+ RTV+ 3TC+ D4T 4
10 DDI+ ABC+ NVP+ D4T 26
11 AZT+ 3TC+ IDV+ RTV 85

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M T74P L10V, I15V, M36I, N37D, R41K, K55R, I62V, L63P, H69K, A71V, L89M, I93L  
>IL384b| codons 4-99
TLWQRPVVTIKVGGQLKEALLDTGADDTVLEEIDLPGKWKPKIIGGIGGFVRVRQYDQVP
IEICGKKVIGPVLVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y A62V Y188L   T39E, T69A, K104R, K122E, R172RK, K173I, Q174R, D177E, I178L, T200A, Q207E, L228LR, V245Q  
>IL384b| codons 38-247
CEELEKEGKISKIGPENPYNTPVFVIKKKDSAKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKRSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKIRNPELVIYQYMDDLLVGSDLEIGQHRAKIEELREHLLRWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004