<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL316 IL316 Israel 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 43
2 NFV+ DDI+ D4T 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VA, I84IV, L90LM Q58QE I13IV, I15IV, G17GD, Q18KR, K20KR, E35ED, M36I, N37ND, R41RK, L63PR, H69HQ, L89LM, I93L  
>IL316| codons 4-99
TLWQRPLVTVKVGDRLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVREYDQIR
IEICGQKAIGTVLVGPTPANVIGRNMMTQLGCTLNF

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005