<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL310 IL310b Israel 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ 3TC+ AZT 136

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, M36I, R41K, H69K, L89M, I93L Q7P
>IL310b| codons 4-99
TLWPRPLVTIKIGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39E, A98S, T107S, K122E, D123N, A158S, K173A, D177E, T200A, Q207E, R211K, V245Q N137NI
>IL310b| codons 38-247
CEEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVSVLDVGDAYFSVPLDENFRKYTAFTIPSINIETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRAQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004