<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL309 IL309b Israel 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NFV 99

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I N88D K20KT, L63LP, I66IF, A71AV, V77I I13S, D25DN
>IL309b| codons 4-99
TLWQRPLVTSKIGGQLTEALLNTGADNTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQIP
IEFCGHKVIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215FY       K49R, K122E, S134X, E169D, I178IL, I202V, E204Q, H208HY, R211Q  
>IL309b| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPXINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDLVIYQYVDDLYVGSDLEIGQHRTKVEQLRQYLLQWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004