<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1484 CA4250 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 152
2 AZT+DDC 82
3 AZT+D4T 26
4 3TC+AZT+D4T 8
5 3TC+D4T+IDV 108

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, M184V, L210W, T215Y K219R     E28K, K32E, E44ED, V60VI, R83K, K122E, S162Y, E169D, D177E, I178L, E204ED, R211K, A272P  
>CA4250| codons 1-278
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRTKIEDLRQHLWKWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L76V, V82A F53FL N37D, L63P, A71V, I93L  
>CA4251| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGLIKVRQYD
QIPIEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005