<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL309 IL309c Israel 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NFV 64

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46MIL   W6WR, L38LM, A71AV, V77I  
>IL309c| codons 4-99
TLRQRPLVTIKIGGQLKEALLDTGADNTVLEEMNMPGRWKPKLIGGIGGFIKVRQYDQIL
IEICGHKVIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004