<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL293 IL293 Israel 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 30
2 DDI+ AZT+ NFV 7

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       T39E, K64R, T69N, A98S, K122E, D123S, A158S, K173A, D177E, T200A, Q207EG, H208HY, R211K, V245Q H235HY
>IL293| codons 38-247
CEEMEKEGKISKIGPENPYNTPVFAIRKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRAQNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELRGYLLKWGFTTP
DKKHQKEPPFLWMGYELYPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10P, K14R, I15V, M36I, N37D, R41RK, H69K, L89M, I93L  
>IL293| codons 4-99
TLWQRPPVTIRVGGQLKEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005