<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL287 IL287 Israel 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ RTV 52
2 AZT+ IDV+ 3TC 104
3 3TC+ AZT+ NFV 8
4 ABC+ DDI+ NFV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       T39E, K102Q, K122E, D123S, I135IT, A158S, S162A, K173AV, Q174K, D177E, T200A, Q207E, R211K, V245Q  
>IL287| codons 38-247
CEELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
SIFQASMTKILEPFRVKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L5LI, L10I, T12S, I15V, L19I, E35D, M36I, R41K, L63T, H69K, A71V, T74S, I93L  
>IL287| codons 4-99
TIWQRPIVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIT
IEICGKKVIGSVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005