<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL280 IL280b Israel 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDC+DDI+NVP 104
3 AZT+DDC+SQV 104
4 ABC+D4T+IDV 97

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84V, L90M   T12S, I15V, Q18L, M36I, R41RK, L63P, H69KR, A71V, T74S, L89M, I93L D29DG, R87RT
>IL280b| codons 4-99
TLWQRPLVSIKVGGLLKEALLDTGAGDTVLEEINLPGKWKPKIIGGIGGFIKVRQYDQIP
IEICGRKVIGSVLVGPTPVNVIGTNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MIV, T215Y K219KE V106M, Y188YC   T39E, D86DN, A98S, K101KR, K122E, D123S, R125RG, S134SG, A158S, S162A, K173A, D177E, I178L, T200A, Q207E, V245Q  
>IL280b| codons 38-247
CEEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQNFWEVQLGIPHP
SGLRKKKSMTVLDVGDAYFSVPLDESFGKYTAFTIPGINNETPGIRYQYNVLPQGWKGSP
SIFQASMTKILEPFRAQNPELVIYQYVDDLCVGSDLEIGQHRAKIEELREHLLRWGFYTP
DEKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004