<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL266 IL266 Israel 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 RTV+ SQV+ AZT 65
2 RTV+ SQV+ 3TC+ AZT 39
3 IDV 13
4 IDV+ RTV 35
5 NFV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IL, I84V, L90M T74TP L10I, I15V, K20KI, E35EG, M36I, R41RK, L63P, H69K, A71V, L89M, Q92QR, I93L R8RG
>IL266| codons 4-99
TLWQGPIVTIKVGGQLIEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFLKVRQYDQIP
IEICGKKVIGPVLVGPTPVNVIGRNMMTRLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y A62V     T39D, S48T, K122E, A158S, K173T, Q174K, T200A, Q207D, R211K, V245Q  
>IL266| codons 38-247
CDEMEKEGKITKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRTKNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004