<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL265 IL265 Israel 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 41
2 3TC+ AZT+ IDV 173

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V L89LV I13V, I15V, K20T, R41K, K55R, I62V, L63P, I64IV, I93L  
>IL265| codons 4-99
TLWQRPLVTVKVGGQLTEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIRVRQYDQVP
VEICGHKAIGTVVVGPTPVNIIGRNVLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V       D123E, S134SG, I135T, S162C, G196GR, T200A, Q207E, R211K, K223KR  
>IL265| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPGTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIRQHRAKIEELREHLLKWGFTTP
DKKHQREPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004