<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL255 IL255 Israel 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ SQV+ DDC 69
2 NFV+ DDI+ 3TC 26
3 3TC+ NFV+ D4T 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN N88ND T12S, I15V, L19IT, E35ED, M36I, R41RK, R57RK, L63P, H69K, T74TS, L89M, I93L P44PL, F99FI
>IL255| codons 4-99
TLWQRPLVSIKVGGQTKEALLDTGADNTVLEDINLPGKWKLKMIGGIGGFIKVKQYDQIP
IEICGKKAIGSVLVGPTPVNIIGRDMLTQLGCTLNI

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184MV, T215TNSY       T39E, S48T, K122E, D123N, A158S, K173A, P176PQ, D177E, G196EK, T200A, I202IV, Q207E, R211RK, V245Q I244IT
>IL255| codons 38-247
CEELEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRAQNQEIVIYQYVDDLYVGSDLEIKQHRAKVEELREHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPTQLP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004