<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1483 CA4247 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 18
2 AZT+ DDC 12
3 DDC+ AZT+ IDV 51
4 D4T+ NFV+ NVP 25
5 ABC+ D4T+ DDI+ RTV+ SQV+ DLV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y188L   I135V, S162CG, G196E, E203EG, R211G, E224X, V245M Q258QH
>CA4247| codons 1-268
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQGSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIEQHRTKIGELRQHLLGWGFTTPDKKHQKDPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIHKLVGKLNWAS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R57RK, L63P, H69Q, V77I  
>CA4248| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005