<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL217 IL217 Israel 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ AZT+ 3TC 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215NY       T39E, S48ST, A98S, K122E, D123G, A158S, K173A, Q174K, D177E, G196E, T200A, E203EK, Q207E, V245Q A129AE
>IL217| codons 38-247
CEEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTEFTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRAKNPEIVIYQYVDDLYVGSDLEIEQHRAKIKELREHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, I13V, K14R, I15V, K20R, E35D, M36I, R41K, L63Q, I64IV, H69Q, L89IM, I93L  
>IL217| codons 4-99
TLWQRPIVTVRVGGQLREALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIQ
VEICGQKAIGTVLVGPTPVNIIGRDMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005